PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca55128.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 319aa    MW: 34988.1 Da    PI: 6.6227
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca55128.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.57.6e-18230263134
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                 C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  Dca55128.1 230 CRHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 263
                 *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.3E-711312IPR016679Transcription factor, GATA, plant
SMARTSM004012.4E-17224274IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.266224260IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-14228262IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.7E-15228287No hitNo description
CDDcd002021.03E-14229276No hitNo description
PfamPF003201.4E-15230263IPR000679Zinc finger, GATA-type
PROSITE patternPS003440230255IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MVETNMTEEI DGGNFFDQFD DLLDFPVDGV DSGIFDSAGV DCTVFPPVWS EDSPDFSAGH  60
SHSASDLSAE LSVPYEDIVQ LEWLSTFVED SFSGGGLTLE RPQTTSSDNK DSFRNQFQTS  120
SPISVLESSS SACSRGKTLP VCHEKRARSK RPRPATFTPR APIQFTSPVP APVTSSESGN  180
FAGSYDSYKG VDKQKTKKRK IKILPPSVSD VLTPTETQNP NSNDGPVRKC RHCEITKTPQ  240
WRAGPMGPKT LCNACGVRYK SGRLYPEYRP AASPTFVPAL HSNSHKKVLE MRGEPEKAVA  300
PPNRKLEHIP KPDLVGTYM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149153KRPRP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683872.11e-122PREDICTED: GATA transcription factor 8
TrEMBLA0A0J8C2J71e-122A0A0J8C2J7_BETVU; Uncharacterized protein
STRINGPOPTR_0010s23010.18e-96(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.24e-40GATA family protein